PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000701148
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 347aa    MW: 38335.8 Da    PI: 7.0937
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000701148genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.41.4e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEd +l  +++q+G+++W++I++  g+ R +k+c++rw +yl
    MDP0000701148 14 RGQWTPEEDNKLSSYIAQHGTRNWRLIPKSAGLQRXGKSCRLRWTNYL 61
                     89********************************************97 PP

2Myb_DNA-binding47.93.1e-1568110246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g ++  E++++v+++   G++ W++Ia++++ gRt++++k++w++
    MDP0000701148  68 GQFSDAEEQIIVKLHSIVGNR-WSLIAARLP-GRTDNDVKNHWNT 110
                      7899*****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-24564IPR009057Homeodomain-like
PROSITE profilePS5129418.923961IPR017930Myb domain
SuperFamilySSF466891.87E-2812108IPR009057Homeodomain-like
SMARTSM007171.4E-121363IPR001005SANT/Myb domain
PfamPF002494.0E-161461IPR001005SANT/Myb domain
CDDcd001671.31E-111761No hitNo description
PROSITE profilePS5129426.2162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-2465116IPR009057Homeodomain-like
SMARTSM007172.3E-1466114IPR001005SANT/Myb domain
PfamPF002492.1E-1368110IPR001005SANT/Myb domain
CDDcd001673.09E-1170112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MGRIPCCEKD TVKRGQWTPE EDNKLSSYIA QHGTRNWRLI PKSAGLQRXG KSCRLRWTNY  60
LRPDLKHGQF SDAEEQIIVK LHSIVGNRWS LIAARLPGRT DNDVKNHWNT KLKKKLSGMG  120
IDPVTHKPFS HLMAEIATTL EPPQAAHLAE AALGFFKDKM LHLLTKKRID FQLQHINPTP  180
GNSTATYSNS KQEXKDDTIE KIKIGLSRAM QEQPDMLTSN KPWMDTTGAS PGNXTGNCSA  240
FPLPMSGFQY GHSTFGNEGD IGSPWSQSLC AGSTCTAAAD QQGQLDDKXE VEENGEESAG  300
GKELRNGSSN IFTSDXLFMI GFAVGFYSAY LIANMVGVEH NDNDEQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008349609.10.0PREDICTED: transcription factor MYB39-like
RefseqXP_008359028.10.0PREDICTED: transcription factor MYB39-like
SwissprotQ7XQN11e-114MYB80_ORYSJ; Transcription factor MYB80
TrEMBLM5WEW70.0M5WEW7_PRUPE; Uncharacterized protein
STRINGVIT_19s0015g01280.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108783039
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.11e-113myb domain protein 103